Search Results

Record: 1 of 1 MiniMap

LANL Gene ID: PG0602GenBank Locus Tag: PG0669DNA Molecule Name: 1 GenBank ID: 34540467Gene Name: cbiK ihtB fetB Definition: heme-binding protein/peripheral outer membrane chelataseCellular Location: Cytoplasm, Periplasm [Evidence]Gene Start: 719894Gene Stop: 720772Gene Length: 879Molecular Weight*: 32612pI*: 6.20Net Charge*: -3.35EC: Functional Class: Cell envelope Gene Ontology:Pathway: pathway tablePrimary Evidence: Veith,P., Talbo,G., Slakeski,N., Dashper,S., Moore,C.,Paolini,R., Reynolds,E., Major outer membrane proteins and proteolytic processing of RgpA, and Kgp of Porphyromonas gingivalis W50, Biochem J. 2002 (in press). Ross BC, Czajkowski L, Hocking D, Margetts M, Webb E, Rothel L, Patterson M, Agius C, Camuglia S, Reynolds E, Littlejohn T, Gaeta B, Ng A, Kuczek ES, Mattick JS, Gearing D, Barr IG, Identification of vaccine candidate antigens from a genomic analysis of Porphyromonas gingivalis, Vaccine 2001 Jul 20;19(30): 4135-42, PMID: 11457538. Hendtlass,A.J., Slakeski,N. and Reynolds,E.C. Porphyromonas gingivalis antigens for the diagnosis and treatment of periodontitis, Patent: Australia AU 97/00212 29-MAR-1997; The University of Melbourne; The School of Dental Science; Melbourne, Victoria, Australia. Jackson,C.A., Hoffmann,B., Slakeski,N., Cleal,S., Hendtlass,A.J. and Reynolds,E.C. 2000. A consensus Porphyromonas gingivalis promoter sequence. FEMS Microbiol. Lett. 186 (1): 133-138. Hendtlass A, Dashper SG, Reynolds EC. Identification of an antigenic protein Pga30 from Porphyromonas gingivalis W50. Oral Microbiol Immunol. 2000 Dec;15(6):383-7. PMID: 11154436 Dashper SG, Hendtlass A, Slakeski N, Jackson C, Cross KJ, Brownfield L, Hamilton R, Barr I, Reynolds EC. Characterization of a novel outer membrane hemin-binding protein of Porphyromonas gingivalis. J Bacteriol. 2000 Nov;182(22):6456-62. PMID: 11053391 Roper JM, Raux E, Brindley AA, Schubert HL, Gharbia SE, Shah HN, Warren MJ. The enigma of cobalamin (Vitamin B12) biosynthesis in Porphyromonas gingivalis. Identification and characterization of a functional corrin pathway. J Biol Chem. 2000 Dec 22;275(51):40316-23. PMID: 11007789Secondary Evidence: Roth JR, Lawrence JG, Rubenfield M, Kieffer-Higgins S, Church GM, Characterization of the cobalamin (vitamin B12) biosynthetic genes of Salmonella typhimurium, J Bacteriol 1993 Jun;175(11):3303-16, PubMed: 8501034.Comment: See ABC Transporters Analysis Veith et al. (2002) identified this protein by two-dimensional gel electrophoresis and peptide mass fingerprinting of outer membranes prepared from strain W50. This protein contains a putative lipoprotein signal sequence. Dashper et al. (2000) rename what had been Pga30. The proximity to a ton_B protein is apparent (PG0601) as well as the contiguity with probable ABC elements (PG0603, PG0604, PG0605). PG0602 also contains a potential SBP domain related to the ABC system. Roper et al. (2000) assign a role in cobalamin biosynthesis to this protein, hence the gene is denoted cbiK. See in this regard PG193 (cbiC), PG0192 (cbiET), PG0191 (cbiGF), PG0190 (cbiJD), PG1040 (cbiA), PG1038 (cbiP), PG1037 (cobD), PG1036 (cobD/cbiB), PG0631 (cobU), PG0632 (cobT), PG0633 (cobS), PG0434 (hemN/F), PG0438 (cbiL), PG0112 (hemH), PG0193 (cbiH). Ross, et al.(2001) select PG0602 as one of fifteen vaccine candidate antigens, based on in vitro and in vivo laboratory studies of 120 candidates screened by bioinformatics techniques from the whole W50 genome. TIGR ID: PG0669Proteomic Data: Proteomic Data Search

TIGR Annotation		heme-binding protein FetB, GroupS (transport and binding proteins)
ORF #		PG-PP/PG-PPC1				PG-PP/PG-PPC2
		Spectral Count		Peptide Intensity		Spectral Count		Peptide Intensity
		Pro	qVal	Pro	qVal	Pro	qVal	Pro	qVal
TIGR	PG0669	-1.22	1.2e-08	-1.83	2.5e-09	-2.17	0	-1.83	2.5e-09
LANL	PG0602	0.43		0.28		0.22		0.10
Consensus		SP1		IP1		SP2		IP2

Human Oral Microbiome Database:
View in HOMD Genome Viewer Blast Summary: PSI-Blast Search Essentially identical (292aa out of 293) to two W50 strain proteins, heme-binding protein FetB (AAF03904) and immunoreactive 33 kD antigen PG125 (AAD38409). Residues 31-287 are 37% similar to CbiK, a cobalamin biosynthesis protein, in Salmonella typhimurium (AAA27262) and residues 31-151 are 42% similar to a CbiK protein in Lactobacillus reuteri (AAG35190). Top Blast Hits: Updated monthly Click here to view the entire PsiBlast results. gi|34540467|ref|NP_904946.1| heme-binding protein FetB [Por... 568 e-160 gi|5052027|gb|AAD38409.1|AF155350_1 immunoreactive 33 kD an... 567 e-160 gi|6110630|gb|AAF03904.1|AF195649_1 heme-binding protein Fe... 566 e-160 gi|78358143|ref|YP_389592.1| Cobalamin biosynthesis protein... 191 6e-47 gi|46579064|ref|YP_009872.1| chelatase, putative [Desulfovi... 179 3e-43 gi|120603353|ref|YP_967753.1| anaerobic cobalt chelatase [D... 178 3e-43 gi|116748542|ref|YP_845229.1| anaerobic cobalt chelatase [S... 177 8e-43 gi|28210463|ref|NP_781407.1| anaerobic cobalt chelatase cbi... 175 2e-42 gi|152971709|ref|YP_001336818.1| hypothetical protein KPN_0... 173 1e-41 gi|148544917|ref|YP_001272287.1| anaerobic cobalt chelatase... 172 2e-41InterPro Summary: InterProScan InterPro IPR010388 Family Anaerobic cobalt chelatase PIRSF033579 Anaer_Co_chel PF06180 CbiK noIPR unintegrated unintegrated G3DSA:3.40.50.1400 G3DSA:3.40.50.1400 PS51257 PROKAR_LIPOPROTEIN SSF53800 SSF53800 COGS Summary: COGS Search No hit to the COGs database. Blocks Summary: Blocks Search No significant hit to the Blocks database. ProDom Summary: Protein Domain Search Residues 31-287 are 37% similar to a (CBIK PROTEIN COBALAMIN BIOSYNTHESIS) protein domain (PD123271 which is seen in CBIK_SALTY. Paralogs: Local Blast Search No paralogs found in P. gingivalis. Pfam Summary: Pfam Search Residues 31 to 292 (E-value = 1.4e-167) place PG0602 in the CbiK family which is described as Cobalt chelatase (CbiK) (PF06180) Structural Feature(s): Feature Type Start Stop cleavable signal 1 15 gram negative signal 1 23 Top PDB Hits: -57% similar to PDB:1QGO ANAEROBIC COBALT CHELATASE IN COBALAMIN BIOSYNTHESIS FROM SALMONELLA TYPHIMURIUM (E_value = 3.6E_38); Gene Protein Sequence: MKKLILATLGLMAIAMLSCSSNNKDLENKGEATLLVTFGSSYKAPRETYA KIEKTFAAAYPDQRISWTYTSSIIRKKLAQQGIYIDAPDEALEKLARLGY KKINVQSLHVIPGREYDEMIDFVNKFKAAHSDITVKVGAPLFDTDEDMRE VAEILHKRFQQTIEKGEAIVFMGHGTEHAANDRYARINKIMKNYSKFMIV GTVESDPSINDVIAELKETGATAVTMMPLMSVAGDHATNDMAGDEDDSWK TLLTNAGYTVSIDKLDNGNFSALGDIEEIRNIWLKHMKATSAR Gene Nucleotide Sequence: Sequence Viewer ATGAAAAAACTGATTTTAGCGACTTTGGGACTTATGGCCATTGCCATGCT CTCATGTTCAAGCAACAACAAGGATTTGGAGAACAAAGGGGAGGCTACTC TTTTGGTAACGTTTGGTAGCTCCTATAAAGCTCCACGCGAAACCTATGCG AAGATTGAGAAGACTTTTGCCGCAGCTTATCCCGATCAAAGGATAAGCTG GACATACACGTCTTCTATTATCCGAAAGAAACTGGCTCAGCAGGGTATTT ATATCGATGCTCCGGATGAGGCTTTGGAGAAATTGGCTCGTCTGGGTTAT AAGAAGATCAATGTACAGAGTCTTCATGTGATTCCCGGCCGAGAATATGA TGAGATGATCGACTTTGTCAATAAGTTTAAGGCAGCACATAGTGATATTA CTGTGAAGGTAGGGGCTCCGCTTTTCGATACCGATGAAGATATGCGCGAG GTGGCAGAGATCTTGCACAAGCGTTTTCAGCAAACGATAGAGAAAGGTGA AGCTATTGTATTCATGGGACACGGCACCGAGCATGCTGCCAATGACAGGT ATGCCCGTATCAATAAGATCATGAAGAACTATAGCAAGTTCATGATCGTC GGAACCGTCGAGTCCGATCCCTCTATCAATGATGTTATTGCCGAACTGAA AGAAACCGGTGCCACGGCCGTAACAATGATGCCGCTGATGAGTGTGGCAG GCGACCATGCTACGAATGATATGGCCGGAGATGAGGACGATAGCTGGAAG ACGTTGCTGACCAATGCCGGCTACACAGTTTCTATAGACAAGCTGGACAA TGGCAATTTCTCAGCTCTTGGAGATATAGAAGAGATCCGGAATATCTGGC TCAAGCATATGAAAGCCACCTCTGCTCGC Los Alamos National Laboratory • Est 1943 Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy

`Feature Type`	`Start`	`Stop`
`cleavable signal`	`1`	`15`
`gram negative signal`	`1`	`23`