Basic Search | Intermediate Search | Advanced Search | Gene Image Map |  Sequence Search |  Protein Motif Search |  Repeat Search |  DNA/RNA Motif Search |  Home

Porphyromonas gingivalis Search Results

Record: 1 of 1  
MiniMap IGR0623 IGR0615 IGR0621 IGR0618 IGR0620 IGR0622 IGR0617 IGR0619 IGR0616 ISPg1, - PG0730 PG0733 PG0734 ISPg1, - PG0731 ruvA, - PG0729 ISPg1, - PG0732 sov, - PG0727 PG0734.1 PG0736 PG0735 ISPg1, - PG0730 PG0733 PG0734 ISPg1, - PG0731 ruvA, - PG0729 ISPg1, - PG0732 sov, - PG0727 PG0734.1 PG0736 PG0735 Type: IS element, Name: ISPg1 fragment - 3 ISPg1, - PG0730 PG0734 ISPg1, - PG0731 ruvA, - PG0729 ISPg1, - PG0732 sov, - PG0727 sov, - PG0728 sov, - PG0728 PG0733 PG0734.1 PG0736 PG0735


LANL Gene ID: PG0731

GenBank Locus Tag:

DNA Molecule Name:
1  

Genomic Island ID:
7

GenBank ID:


Gene Name:
ISPg1  

Definition:
ISPg1 fragment (IS1106-related element)

Cellular Location:
Cytoplasm [Evidence]

Gene Start:
874752

Gene Stop:
874255

Gene Length:
498

Molecular Weight*:
18809

pI*:
5.10

Net Charge*:
-4.32

EC:
 

Functional Class:
Transposon functions  

Gene Ontology:

Pathway: pathway table

Primary Evidence:
Hanley,S.A., Aduse-Opoku,J. and Curtis,M.A.
A 55-kilodalton immunodominant antigen of Porphyromonas gingivalis
W50 has arisen via horizontal gene transfer
Infect. Immun. 67 (3), 1157-1171 (1999)

Maley,J. and Roberts,I.S.
Characterisation of IS1126 from Porphyromonas gingivalis W83: a new member of the IS4 family of insertion sequence elements
Microbiol. Lett. 123 (1-2), 219-224 (1994)

Shibata,Y., Hayakawa,M., Takiguchi,H., Shiroza,T. and Abiko,Y.
Determination and characterization of the hemagglutinin-associated
short motifs found in Porphyromonas gingivalis multiple gene
products. J. Biol. Chem. 274 (8), 5012-5020 (1999)

Comment:
Member of the IS5 family of elements.

NO TIGR ID corresponds to this gene.

Human Oral Microbiome Database:
View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
PG1662 is equivalent to the N-terminal residues of the previously sequenced AJ130872 and AB015879 in GenBANK.

Several hits in gapped BLAST to previously sequenced transposases in P.gingivalis. Residues 34-134 are 39% similar to the ORF1169a from B.fragilis (X76949).

Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|4001716|dbj|BAA35090.1|  ORF7 [Porphyromonas gingivalis]       202   4e-51
 gi|34540279|ref|NP_904758.1|  ISPg1, transposase [Porphyromo...   202   7e-51
 gi|34540041|ref|NP_904520.1|  ISPg1, transposase [Porphyromo...   201   2e-50
 gi|3901097|emb|CAA10225.1|  transposase [Porphyromonas gingi...   198   8e-50
 gi|3869078|dbj|BAA34342.1|  Insertion sequence IS1126-like g...   169   7e-41
 gi|34541013|ref|NP_905492.1|  ISPg1, transposase, internal d...   162   8e-39
 gi|1361314|pir||S57895  hypothetical protein 1 - Porphyromon...   149   4e-35
 gi|91218509|ref|ZP_01255448.1|  ISPg1, transposase [Psychrof...   149   4e-35
 gi|91216745|ref|ZP_01253710.1|  ISPg1, transposase [Psychrof...   146   3e-34
 gi|85860468|ref|YP_462670.1|  transposase [Syntrophus acidit...   100   2e-20


InterPro Summary:  InterProScan

No hits reported.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
No significant hit to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-84 are 63% similar to a (TRANSPOSASE PROTEIN INSERTION ELEMENT) protein domain (PD007264 which is seen in Q9ZNB4_PORGI.

Residues 85-132 are 62% similar to a (TRANSPOSASE ORF7 INSERTION SEQUENCE IS1126-LIKE GENE) protein domain (PD187846 which is seen in Q9ZA61_PORGI.


Paralogs:  Local Blast Search
PG0731 is virtually identical to PG0884, another ISPg1 fragment, and similar to PG1662, PG1422, PG1267, PG1062, PG1050, PG0918, PG0740, PG0169, PG0499, PG0420, PG0732, PG0842, PG1159, PG1607, PG1919, PG1798, PG1755, PG1665, PG1230, PG1215, PG1184, PG1087, PG0839, PG0763, PG0756, PG0689, PG0686, PG1895, PG0044, PG1608, all ISPg1-related sequences. Specifically PG0731 and PG0884 correspond to most of the N-terminal domains of full-length ISPg1 elements such as PG1662.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

Top PDB Hits:
No significant hits to the PDB database (E-value < E-10).

Gene Protein Sequence:
MKHSFLRQINAGFDWRGIRTLLNKKYTKTQNAIGNPAYDALLMFKILLLE
TWYGLSDYEVEECINDSLLFSEFLGLDLGFPSPDHSTISRFRSELTRLGI
MDKLLRELNKQFKKHGISRIDQGAIVDASIVDSPYAPDGNVVIEVAEDRE
DTRSEEARTQPGGLSL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACACTCTTTCCTGCGTCAAATCAATGCCGGTTTTGATTGGCGTGG
TATTCGCACACTGCTGAACAAGAAATACACCAAGACACAGAATGCCATAG
GTAACCCTGCCTACGATGCGCTGTTGATGTTCAAGATTCTACTCTTGGAG
ACTTGGTATGGTTTGAGTGACTACGAGGTTGAGGAGTGCATCAACGACTC
CTTGCTTTTCAGTGAATTCCTTGGCTTGGACCTCGGCTTCCCTTCCCCCG
ACCATAGCACGATCAGTCGTTTCCGTAGTGAACTCACTCGCTTGGGGATT
ATGGATAAACTCCTTCGGGAGCTGAACAAGCAGTTCAAGAAGCACGGCAT
CAGCCGTATCGATCAAGGCGCCATCGTTGATGCGAGCATTGTGGATAGTC
CTTACGCCCCTGATGGCAACGTGGTCATAGAAGTGGCTGAAGATCGAGAG
GATACTCGTTCGGAGGAAGCTCGTACACAGCCAGGAGGCTTATCATTG


Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy