Basic Search | Intermediate Search | Advanced Search | Gene Image Map |  Sequence Search |  Protein Motif Search |  Repeat Search |  DNA/RNA Motif Search |  Home

Porphyromonas gingivalis Search Results

Record: 1 of 1  
MiniMap IGR0750 IGR0753.1 IGR0752 IGR0754 IGR0749 IGR0753 IGR0751 IGR0755 IGR0756 rl35, - PG0886.1 PG0879 ISPg2, - PG0889 rl20, - PG0886 ISPg1, - PG0883 ISPg1, - PG0884 infC, - PG0887 PG0881 thrS, - PG0888 PG0880 PG0885 PG0882 PG0878 rl35, - PG0886.1 PG0879 ISPg2, - PG0889 rl20, - PG0886 ISPg1, - PG0883 ISPg1, - PG0884 infC, - PG0887 PG0881 thrS, - PG0888 PG0880 PG0885 PG0882 PG0878 Type: IS element, Name: ISPg1 fragment - 3 PG0879 ISPg2, - PG0889 rl20, - PG0886 ISPg1, - PG0883 ISPg1, - PG0884 infC, - PG0887 PG0881 thrS, - PG0888 rl35, - PG0886.1 PG0885 PG0882 PG0878 PG0879.1 PG0880 PG0879.1


LANL Gene ID: PG0884

GenBank Locus Tag:

DNA Molecule Name:
1  

GenBank ID:


Gene Name:
ISPg1  

Definition:
ISPg1 fragment

Cellular Location:
Cytoplasm [Evidence]

Gene Start:
1050259

Gene Stop:
1049762

Gene Length:
498

Molecular Weight*:
18809

pI*:
5.10

Net Charge*:
-4.32

EC:
 

Functional Class:
Transposon functions  

Gene Ontology:

Pathway: pathway table

Primary Evidence:
Hanley,S.A., Aduse-Opoku,J. and Curtis,M.A.
A 55-kilodalton immunodominant antigen of Porphyromonas gingivalis
W50 has arisen via horizontal gene transfer
Infect. Immun. 67 (3), 1157-1171 (1999)

Maley,J. and Roberts,I.S.
Characterisation of IS1126 from Porphyromonas gingivalis W83: a new member of the IS4 family of insertion sequence elements
Microbiol. Lett. 123 (1-2), 219-224 (1994)

Shibata,Y., Hayakawa,M., Takiguchi,H., Shiroza,T. and Abiko,Y.
Determination and characterization of the hemagglutinin-associated
short motifs found in Porphyromonas gingivalis multiple gene
products. J. Biol. Chem. 274 (8), 5012-5020 (1999)

Secondary Evidence:
Knight,A.I., Ni,H., Cartwright,K.A. and McFadden,J.J.
Identification and characterization of a novel insertion sequence, IS1106, downstream of the porA gene in B15 Neisseria meningitidis.
Mol. Microbiol. 6 (11), 1565-1573 (1992)

Comment:
Member of the IS5 family of elements. PG0883 and PG0884 could together constitute a full-length ISPg1 element such as PG1662.

NO TIGR ID corresponds to this gene.

Human Oral Microbiome Database:
View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
PG0884 is similar to portions of the previously sequenced ISPg1 transposases in GenBANK, AB015879, AJ130872, AB019363. REsidues 34-134 are 39% similar to (X76949) of ORF1169a in Bacteroides fragilis.

Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|4001716|dbj|BAA35090.1|  ORF7 [Porphyromonas gingivalis]       202   4e-51
 gi|34540279|ref|NP_904758.1|  ISPg1, transposase [Porphyromo...   202   7e-51
 gi|34540041|ref|NP_904520.1|  ISPg1, transposase [Porphyromo...   201   2e-50
 gi|3901097|emb|CAA10225.1|  transposase [Porphyromonas gingi...   198   8e-50
 gi|3869078|dbj|BAA34342.1|  Insertion sequence IS1126-like g...   169   7e-41
 gi|34541013|ref|NP_905492.1|  ISPg1, transposase, internal d...   162   8e-39
 gi|1361314|pir||S57895  hypothetical protein 1 - Porphyromon...   149   4e-35
 gi|91218509|ref|ZP_01255448.1|  ISPg1, transposase [Psychrof...   149   4e-35
 gi|91216745|ref|ZP_01253710.1|  ISPg1, transposase [Psychrof...   146   3e-34
 gi|85860468|ref|YP_462670.1|  transposase [Syntrophus acidit...   100   2e-20


InterPro Summary:  InterProScan

No hits reported.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
No significant hit to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-84 are 63% similar to a (TRANSPOSASE PROTEIN INSERTION ELEMENT) protein domain (PD007264 which is seen in Q9ZNB4_PORGI.

Residues 85-132 are 62% similar to a (TRANSPOSASE ORF7 INSERTION SEQUENCE IS1126-LIKE GENE) protein domain (PD187846 which is seen in Q9ZA61_PORGI.


Paralogs:  Local Blast Search
PG0884 is virtually identical to PG0731 and similar to N-terminal regions of PG1662, PG1422, PG1267, PG1062, PG1050, PG0918, PG0740, PG0169, PG1099, PG0499, PG0420, PG0732, PG0842, PG1159, PG1607, PG1919, PG1798, PG1755, PG1665, PG1230, PG1215, PG1184, PG1087, PG0839, PG0763, PG0756, PG0689, PG0686, PG1895, PG0044, PG1608, all ISPg1-related transposases or fragments.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

Top PDB Hits:
No significant hits to the PDB database (E-value < E-10).

Gene Protein Sequence:
MKHSFLRQINAGFDWRGIRTLLNKKYTKTQNAIGNPAYDALLMFKILLLE
TWYGLSDYEVEECINDSLLFSEFLGLDLGFPSPDHSTISRFRSELTRLGI
MDKLLRELNKQFKKHGISRIDQGAIVDASIVDSPYAPDGNVVIEVAEDRE
DTRSEEARTQPGGLSL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACACTCTTTCCTGCGTCAAATCAATGCCGGTTTTGATTGGCGTGG
TATTCGCACACTGCTGAACAAGAAATACACCAAGACACAGAATGCCATAG
GTAACCCTGCCTACGATGCGCTGTTGATGTTCAAGATTCTACTCTTGGAG
ACTTGGTATGGTTTGAGTGACTACGAGGTTGAGGAGTGCATCAACGACTC
CTTGCTTTTCAGTGAATTCCTTGGCTTGGACCTCGGCTTCCCTTCCCCCG
ACCATAGCACGATCAGTCGTTTCCGTAGTGAACTCACTCGCTTGGGGATT
ATGGATAAACTCCTTCGGGAGCTGAACAAGCAGTTCAAGAAGCACGGCAT
CAGCCGTATCGATCAAGGCGCCATCGTTGATGCGAGCATTGTGGATAGTC
CTTACGCCCCTGATGGCAACGTGGTCATAGAAGTGGCTGAAGATCGAGAG
GATACTCGTTCGGAGGAAGCTCGTACACAGCCAGGAGGCTTATCATTG


Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy