Basic Search | Intermediate Search | Advanced Search | Gene Image Map |  Sequence Search |  Protein Motif Search |  Repeat Search |  DNA/RNA Motif Search |  Home

Porphyromonas gingivalis Search Results

Record: 1 of 1  
MiniMap IGR1053 IGR1059 IGR1058 IGR1052 IGR1050 IGR1057 IGR1056 IGR1055 IGR1051 IGR1054 PG1228.1 PG1229 PG1235 ISPg1, - PG1230 PG1234 PG1233 mreB, - PG1227 tnaA, - PG1232 purH,purJ, - PG1228 PG1236 ISPg1, - PG1231 PG1228.1 PG1229 PG1235 ISPg1, - PG1230 PG1234 PG1233 mreB, - PG1227 tnaA, - PG1232 purH,purJ, - PG1228 PG1236 ISPg1, - PG1231 Type: IS element, Name: ISPg1 - 2 PG1229 ISPg1, - PG1230 PG1234 PG1233 mreB, - PG1227 tnaA, - PG1232 purH,purJ, - PG1228 PG1236 PG1228.1 PG1235 ISPg1, - PG1231


LANL Gene ID: PG1231

GenBank Locus Tag: PG1400

DNA Molecule Name:
1  

GenBank ID:


Gene Name:
ISPg1  

Definition:
ISPg1 fragment

Cellular Location:
Cytoplasm, Extracellular [Evidence]

Gene Start:
1483000

Gene Stop:
1483233

Gene Length:
234

Molecular Weight*:
9005

pI*:
12.00

Net Charge*:
14.31

EC:
 

Functional Class:
Transposon functions  

Gene Ontology:
Biological process
  GO:0006313    transposition, DNA-mediated

Molecular function
  GO:0003677    DNA binding
  GO:0004803    transposase activity


Pathway: pathway table

Primary Evidence:
Hanley,S.A., Aduse-Opoku,J. and Curtis,M.A.
A 55-kilodalton immunodominant antigen of Porphyromonas gingivalis
W50 has arisen via horizontal gene transfer
Infect. Immun. 67 (3), 1157-1171 (1999)

Maley,J. and Roberts,I.S.
Characterisation of IS1126 from Porphyromonas gingivalis W83: a new member of the IS4 family of insertion sequence elements
Microbiol. Lett. 123 (1-2), 219-224 (1994)

Shibata,Y., Hayakawa,M., Takiguchi,H., Shiroza,T. and Abiko,Y.
Determination and characterization of the hemagglutinin-associated
short motifs found in Porphyromonas gingivalis multiple gene
products. J. Biol. Chem. 274 (8), 5012-5020 (1999)

Secondary Evidence:
Knight,A.I., Ni,H., Cartwright,K.A. and McFadden,J.J.
Identification and characterization of a novel insertion sequence, IS1106, downstream of the porA gene in B15 Neisseria meningitidis.
Mol. Microbiol. 6 (11), 1565-1573 (1992)

Comment:
Member of the IS5 family of elements.

TIGR ID: PG1400

Human Oral Microbiome Database:
View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
PG1231 is equivalent to the C-terminal regions of the previously sequenced AJ130872 and AB015879 in GenBANK. Residues 1-65 are 44% similar to residues 247-311 of the IS1106 sequence of N.meningitidis (AE002488).

Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|3901097|emb|CAA10225.1|  transposase [Porphyromonas gingi...   105   7e-22
 gi|34540041|ref|NP_904520.1|  ISPg1, transposase [Porphyromo...   105   8e-22
 gi|1361314|pir||S57895  hypothetical protein 1 - Porphyromon...   104   2e-21
 gi|34540279|ref|NP_904758.1|  ISPg1, transposase [Porphyromo...   104   2e-21
 gi|4001716|dbj|BAA35090.1|  ORF7 [Porphyromonas gingivalis]       103   3e-21
 gi|91218509|ref|ZP_01255448.1|  ISPg1, transposase [Psychrof...    87   2e-16
 gi|34541013|ref|NP_905492.1|  ISPg1, transposase, internal d...    84   3e-15
 gi|3869078|dbj|BAA34342.1|  Insertion sequence IS1126-like g...    79   7e-14
 gi|91217658|ref|ZP_01254615.1|  ISPg1, transposase [Psychrof...    70   5e-11
 gi|15677260|ref|NP_274413.1|  IS1106 transposase [Neisseria ...    56   6e-07


InterPro Summary:  InterProScan

InterPro
IPR002559
Domain
Transposase, IS4-like
PF01609 [21-65]T 1.3e-07 PF01609 Transposase_11 Transposase_11


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
No significant hit to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 21-73 are 73% similar to a (TRANSPOSASE ORF7 INSERTION SEQUENCE) protein domain (PD187845 which is seen in Q9ZA61_PORGI.


Paralogs:  Local Blast Search
PG1231 is similar to the C-terminal regions of PG0883, PG0730, PG1919, PG1798, PG1755, PG1662, PG1422, PG1267, PG1230, PG1184, PG1087, PG1062, PG1050, PG0918, PG0763, PG0756, PG0740, PG0686, PG0169, PG0044, PG0689, PG1099, PG0499, PG0420, PG1895, PG1665, PG1215, PG0839, PG1608, PG1159, all ISPg1-related elements.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

Top PDB Hits:
No significant hits to the PDB database (E-value < E-10).

Gene Protein Sequence:
MLKAHRGQALSESQKQLNRMISKTRCLIERTFGSIRRWFCGGRCRYRGLA
KTHTRNILEAMAYNLKRMPGLLVLQGAK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAAGGCCCATCGAGGTCAAGCCCTCAGTGAAAGTCAGAAACAACT
CAATCGGATGATCAGTAAGACGCGCTGCTTGATAGAACGTACCTTCGGTA
GTATTCGACGATGGTTCTGTGGCGGACGATGTCGCTACCGAGGGTTAGCC
AAGACACATACCCGGAATATCCTTGAAGCTATGGCCTACAATCTCAAGCG
TATGCCGGGGCTTCTTGTGCTTCAAGGCGCAAAA


Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy