Basic Search | Intermediate Search | Advanced Search | Gene Image Map |  Sequence Search |  Protein Motif Search |  Repeat Search |  DNA/RNA Motif Search |  Home

Porphyromonas gingivalis Search Results

Record: 1 of 1  
MiniMap IGR1371 IGR1370 IGR1368 IGR1369 PG1609 spo, - PG1610 PG1612 dfp, - PG1613 recN, - PG1611 ISPg1, - PG1607 hagD,prtK,prtP,kgp, - PG1605 PG1609 spo, - PG1610 PG1612 dfp, - PG1613 recN, - PG1611 ISPg1, - PG1607 hagD,prtK,prtP,kgp, - PG1605 Type: IS element, Name: ISPg1 fragment - 3 Type: IS element, Name: ISPg1 fragment - 3 PG1609 spo, - PG1610 PG1612 dfp, - PG1613 recN, - PG1611 hagD,prtK,prtP,kgp, - PG1605 ISPg1, - PG1608 ISPg1, - PG1607 ISPg1, - PG1608


LANL Gene ID: PG1608

GenBank Locus Tag:

DNA Molecule Name:
1  

GenBank ID:


Gene Name:
ISPg1  

Definition:
ISPg1 fragment

Cellular Location:
Cytoplasm [Evidence]

Gene Start:
1945589

Gene Stop:
1945915

Gene Length:
327

Molecular Weight*:
12484

pI*:
11.20

Net Charge*:
7.14

EC:
 

Functional Class:
Transposon functions  

Gene Ontology:
Biological process
  GO:0006313    transposition, DNA-mediated

Molecular function
  GO:0003677    DNA binding
  GO:0004803    transposase activity


Pathway: pathway table

Primary Evidence:
Hanley,S.A., Aduse-Opoku,J. and Curtis,M.A.
A 55-kilodalton immunodominant antigen of Porphyromonas gingivalis
W50 has arisen via horizontal gene transfer
Infect. Immun. 67 (3), 1157-1171 (1999)

Maley,J. and Roberts,I.S.
Characterisation of IS1126 from Porphyromonas gingivalis W83: a new member of the IS4 family of insertion sequence elements
Microbiol. Lett. 123 (1-2), 219-224 (1994)

Shibata,Y., Hayakawa,M., Takiguchi,H., Shiroza,T. and Abiko,Y.
Determination and characterization of the hemagglutinin-associated
short motifs found in Porphyromonas gingivalis multiple gene
products. J. Biol. Chem. 274 (8), 5012-5020 (1999)

Comment:
Member of the IS5 family of elements. A fragment.

NO TIGR ID corresponds to this gene.

Human Oral Microbiome Database:
View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
PG1608 is equivalent in part to the previously sequenced IS1126-related transposase AB019363 in GenBANK. No similarities to sequences not found in P.gingivalis.

Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|34541013|ref|NP_905492.1|  ISPg1, transposase, internal d...   209   5e-53
 gi|3869078|dbj|BAA34342.1|  Insertion sequence IS1126-like g...   205   8e-52
 gi|1361314|pir||S57895  hypothetical protein 1 - Porphyromon...   117   2e-25
 gi|34540279|ref|NP_904758.1|  ISPg1, transposase [Porphyromo...   117   2e-25
 gi|4001716|dbj|BAA35090.1|  ORF7 [Porphyromonas gingivalis]       116   4e-25
 gi|3901097|emb|CAA10225.1|  transposase [Porphyromonas gingi...   114   2e-24
 gi|34540041|ref|NP_904520.1|  ISPg1, transposase [Porphyromo...   114   2e-24
 gi|91218509|ref|ZP_01255448.1|  ISPg1, transposase [Psychrof...    79   1e-13
 gi|91217658|ref|ZP_01254615.1|  ISPg1, transposase [Psychrof...    75   1e-12
 gi|91216745|ref|ZP_01253710.1|  ISPg1, transposase [Psychrof...    60   3e-08


InterPro Summary:  InterProScan

InterPro
IPR002559
Domain
Transposase, IS4-like
PF01609 [55-96]T 1.7e-07 PF01609 Transposase_11 Transposase_11


COGS Summary:  COGS Search
No hit to the COGs database.
Blocks Summary:  Blocks Search
No significant hit to the Blocks database.

 ProDom Summary:  Protein Domain Search
Residues 51-109 are 96% similar to a (TRANSPOSASE ORF7 INSERTION SEQUENCE IS1126-LIKE GENE) protein domain (PD187845 which is seen in Q9ZNB4_PORGI.

Residues 8-54 are 97% similar to a (TRANSPOSASE ORF7 INSERTION SEQUENCE) protein domain (PD187846 which is seen in Q9ZA61_PORGI.


Paralogs:  Local Blast Search
PG1608 is similar to mid-portions of PG1919, PG1798, PG1230, PG0756, PG0689, PG0044, PG0499, PG0420, PG1895, PG1215, PG0839, PG1665, PG1755, PG1662, PG1422, PG1267, PG1184, PG1087, PG1062, PG1050, PG0918, PG0763, PG0740, PG0686, PG0169, PG0842, PG0732, PG0883, PG1231, PG0730, PG0884, PG0731, all ISPg1-related transposases. In particular, it is most similar to PG1159, a fragment.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

 Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

Top PDB Hits:
No significant hits to the PDB database (E-value < E-10).

Gene Protein Sequence:
MEEVSPDHSTISRFRSALTELGLMDKLLAQFNKQLSRHHISVRERVLVDA
SLVEIRSTIERTFGSIRRWFHGGRCRYRGLAKTHTQNILESIAFNLYRTP
GIIMSSSLG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGAGGTATCTCCCGACCACAGCACCATCAGTCGATTTCGTTCGGC
ACTGACAGAGTTGGGGCTCATGGACAAACTATTGGCGCAGTTTAACAAAC
AACTTTCCCGCCATCACATTTCGGTCAGGGAAAGGGTGCTTGTCGATGCA
AGCCTTGTGGAGATACGGAGCACCATCGAACGCACCTTTGGCAGTATTCG
CCGGTGGTTTCATGGCGGACGATGTCGATACCGGGGACTTGCCAAGACCC
ATACTCAAAACATTCTTGAAAGCATCGCCTTTAATTTATACAGAACCCCG
GGGATAATTATGTCCTCATCTCTAGGA

Los Alamos National Laboratory • Est 1943

Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy